PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009605864.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 733aa    MW: 80617.3 Da    PI: 5.758
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009605864.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.64.9e-1962117156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++e+e++F+++++p+ ++r+eL k+l L+  qVk+WFqN+R+++k
  XP_009605864.1  62 KKRYHRHTQHQIQEMESFFKECPHPDDKQRKELGKRLALEPLQVKFWFQNKRTQMK 117
                     688999***********************************************998 PP

2START226.57.8e-712504711206
                     HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                     ela +a++el+++a+++ep+W  s+     e++ ++e++++f+++ +      ++ea+r+s+vv+m++ +lve+l+d++ qW++ +a    ka+t
  XP_009605864.1 250 ELAVAAMEELIRMAQSGEPLWLPSPninstEILSEEEYVRNFPRGIGpnplaLKSEASRESAVVIMNHINLVEILMDVN-QWTNVFAglvsKAMT 343
                     57899***************************************999********************************.*************** PP

                     EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
           START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                     lev+s+g      galq+m+ae+q++splvp R+ +fvRy++q+ +g+w++vdvS+d+ ++ +    v R++++pSg+li++++ng+skvtwveh
  XP_009605864.1 344 LEVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKQHADGTWAVVDVSLDNLRPTS----VSRCRRRPSGCLIQELPNGYSKVTWVEH 434
                     ************************************************************975....8*************************** PP

                     EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     v+++++ +h+++++lv+sgla+gak+wvatl+rqce+
  XP_009605864.1 435 VEVDEKAVHSIYKPLVNSGLAFGAKRWVATLDRQCER 471
                     ***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-2244117IPR009057Homeodomain-like
SuperFamilySSF466895.01E-1847119IPR009057Homeodomain-like
PROSITE profilePS5007116.1859119IPR001356Homeobox domain
SMARTSM003893.3E-1660123IPR001356Homeobox domain
CDDcd000868.81E-1762120No hitNo description
PfamPF000461.1E-1662117IPR001356Homeobox domain
PROSITE profilePS5084846.803241474IPR002913START domain
SuperFamilySSF559619.34E-38242473No hitNo description
CDDcd088751.27E-129245470No hitNo description
SMARTSM002341.1E-70250471IPR002913START domain
PfamPF018522.6E-59251471IPR002913START domain
Gene3DG3DSA:3.30.530.201.8E-6321471IPR023393START-like domain
SuperFamilySSF559612.31E-25491725No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MFNGNMFDSH HHLLDMSAHN KTPENEMDFI RDEEFESKSG TDIMEAPNSG DDQDPNQRPN  60
KKKRYHRHTQ HQIQEMESFF KECPHPDDKQ RKELGKRLAL EPLQVKFWFQ NKRTQMKAQH  120
ERSENTQLRN ENEKLRAENI RYKEALSNAA CPNCGGPAAI GEMSFDEQHL RIENARLREE  180
IDRISGIAAK YVGGKPLLNF PQIPPPEASC SLDLGFRPQS SLLGEMYSAG DLLRTAISGL  240
TDSEKPIVIE LAVAAMEELI RMAQSGEPLW LPSPNINSTE ILSEEEYVRN FPRGIGPNPL  300
ALKSEASRES AVVIMNHINL VEILMDVNQW TNVFAGLVSK AMTLEVLSTG VAGNYNGALQ  360
VMTAEFQVPS PLVPTRENYF VRYCKQHADG TWAVVDVSLD NLRPTSVSRC RRRPSGCLIQ  420
ELPNGYSKVT WVEHVEVDEK AVHSIYKPLV NSGLAFGAKR WVATLDRQCE RLASAMANNI  480
PTGDVGIITS PAGRKSMLKL AERMVMSFCA GVGASTTHTW TTLSGSGADD VRVMTRKSID  540
DPGRPPGIVL SAATSFWLPV SPKRVFDFLR DENSRSEWDI LSNGGLVQEM AHIANGRDPG  600
NCVSLLRVNS GNSNQSNMLI LQESSTDSTG SYVIYAPVDI VAMNVVLSGG DPDYVALLPS  660
GFAILPDGSL TNHSGDNPEV IGNSGGSLLT VAFQILVDSV PTAKLSLGSV ATVNSLIKCT  720
VERIKTAVTC ENA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605863.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
RefseqXP_009605864.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A022QKL80.0A0A022QKL8_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000052770.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2